PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG004063.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 327aa    MW: 37008.4 Da    PI: 6.1315
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG004063.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-162572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++    G g+W+ Iar  g++R++k+c++rw +yl
      CCG004063.1 25 KGLWSPEEDEKLIKYMLTNGQGCWSEIARNAGLHRCGKSCRLRWINYL 72
                     678*******************************************97 PP

2Myb_DNA-binding52.51.1e-1678122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++ 
      CCG004063.1  78 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 122
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4842072IPR017930Myb domain
SuperFamilySSF466894.49E-2923119IPR009057Homeodomain-like
SMARTSM007172.1E-142474IPR001005SANT/Myb domain
PfamPF002491.1E-142572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-242679IPR009057Homeodomain-like
CDDcd001672.81E-112872No hitNo description
PROSITE profilePS5129424.88773127IPR017930Myb domain
SMARTSM007171.8E-1677125IPR001005SANT/Myb domain
PfamPF002492.7E-1578122IPR001005SANT/Myb domain
CDDcd001671.26E-1180123No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2680126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MRKPDLMARD RVPVNNNMNR AKLRKGLWSP EEDEKLIKYM LTNGQGCWSE IARNAGLHRC  60
GKSCRLRWIN YLRPDLKRGA FSPQEEELII HLHSILGNRW SQIAARLPGR TDNEIKNFWN  120
STLKKRFKID SNSTSSPNDS TDSSEPRDHV VGNIMPLHDH DVMTLCKDSS SSPSISMHGV  180
VTGNQFDPFT VLSNRYDVRG AASLFDMSPC LTQVGMGDGF YGDHYGILEG NNKIGLESDL  240
SLPPLESRSI EENNAVSNNR IGVKSSSNDN HHFDSTCFNN TDQTFKVEDM LGLENHWQGE  300
NVRMGEWDLE GLMENISSFP FLDFQAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27231275108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486750.0KF148675.1 Populus trichocarpa MYB transcription factor (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047407.10.0PREDICTED: transcription factor MYB46-like
TrEMBLB9GFE80.0B9GFE8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s27430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-88myb domain protein 83